Introduction | Checking Sequence Agreement | Merging Sequences | Adjusting Sequences | All Earlier Events, All Later Events
Package: eratosthenes 1.0.4
eratosthenes: Archaeological Synchronism
Estimation of unknown historical or archaeological dates subject to relationships with other relative dates and absolute constraints, derived as marginal densities from the full joint conditional, using a two-stage Gibbs sampler with consistent batch means to assess convergence. Features reporting on Monte Carlo standard errors, as well as tools for rule-based estimation of dates of production and use of artifact types, aligning and checking relative sequences, and evaluating the impact of the omission of relative/absolute events upon one another. Collins-Elliott (2026) "eratosthenes: Synchronizing archaeological chronologies with a focus on artifact types" <doi:10.21105/joss.09260>.
Authors:
eratosthenes_1.0.4.tar.gz
eratosthenes_1.0.4.zip(r-4.7-x86_64)eratosthenes_1.0.4.zip(r-4.7-arm64)eratosthenes_1.0.4.zip(r-4.6-x86_64)eratosthenes_1.0.4.zip(r-4.6-arm64)eratosthenes_1.0.4.zip(r-4.5-x86_64)
eratosthenes_1.0.4.tgz(r-4.6-x86_64)eratosthenes_1.0.4.tgz(r-4.6-arm64)eratosthenes_1.0.4.tgz(r-4.5-x86_64)eratosthenes_1.0.4.tgz(r-4.5-arm64)
eratosthenes_1.0.4.tar.gz(r-4.7-arm64)eratosthenes_1.0.4.tar.gz(r-4.7-x86_64)eratosthenes_1.0.4.tar.gz(r-4.6-arm64)eratosthenes_1.0.4.tar.gz(r-4.6-x86_64)
eratosthenes_1.0.4.tgz(r-4.6-emscripten)
manual.pdf |manual.html✨
DESCRIPTION
card.svg |card.png
eratosthenes/json (API)
| # Install 'eratosthenes' in R: |
| install.packages('eratosthenes', repos = c('https://scollinselliott.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/scollinselliott/eratosthenes/issues
archaeologychronologygibbs-samplercpp
Last updated from:17b71adf45. Checks:15 OK. Indexed: yes.
| Target | Result | Time | Files | Syslog |
|---|---|---|---|---|
| linux-devel-arm64 | OK | 143 | ||
| linux-devel-x86_64 | OK | 140 | ||
| source / vignettes | OK | 172 | ||
| linux-release-arm64 | OK | 143 | ||
| linux-release-x86_64 | OK | 157 | ||
| macos-release-arm64 | OK | 157 | ||
| macos-release-x86_64 | OK | 255 | ||
| macos-oldrel-arm64 | OK | 132 | ||
| macos-oldrel-x86_64 | OK | 318 | ||
| windows-devel-arm64 | OK | 290 | ||
| windows-devel-x86_64 | OK | 188 | ||
| windows-release-arm64 | OK | 244 | ||
| windows-release-x86_64 | OK | 137 | ||
| windows-oldrel-x86_64 | OK | 158 | ||
| wasm-release | OK | 83 |
Exports:absoluteassemblageconstraintseventsfindsgibbs_adgibbs_ad_typehistogramids_of_typesmsdquae_anteaquae_posteaseq_adjseq_diagsequencessq_dispsynth_ranktidy_marginalstraceplot
Dependencies:clifarvergluelifecyclemagrittrpaletteerpillarpkgconfigprismaticrbibutilsRcppRdpackrematch2rlangrstudioapitibbleutf8vctrs
Readme and manuals
Help Manual
| Help page | Topics |
|---|---|
| Create an Absolute Constraint Object | absolute absolute.character |
| Create an Assemblage Object | assemblage assemblage.finds assemblage.list |
| Create an Constraints Object | constraints constraints.absolute constraints.list |
| Create an Events Object | events events.character |
| Create an Finds Object | finds finds.character |
| Gibbs Sampler for Archaeological Dates | gibbs_ad gibbs_ad.list gibbs_ad.sequences |
| Gibbs Sampler for Archaeological Dates: Artifact Types | gibbs_ad_type gibbs_ad_type.sequences |
| Histogram of Marginal Densities | histogram histogram.marginals histogram.type_marginals |
| Ids of Types | ids_of_types ids_of_types.assemblage |
| Mean Squared Displacement of Events | msd msd.marginals |
| Quae Antea | quae_antea quae_antea.events quae_antea.list quae_antea.sequences |
| Quae Postea | quae_postea quae_postea.events quae_postea.list quae_postea.sequences |
| Adjust Sequence to Target | seq_adj seq_adj.events |
| Sequence Diagnostic | seq_diag seq_diag.events seq_diag.list |
| Create a Sequences Object | sequences sequences.events sequences.list |
| Squared Displacement for a Target Event | sq_disp sq_disp.marginals sq_disp.type_marginals |
| Synthetic Ranking | synth_rank synth_rank.sequences |
| Convert Marginals to Tidy (Molten) Data Frame | tidy_marginals tidy_marginals.marginals tidy_marginals.type_marginals |
| Traceplot of Gibbs Samples | traceplot traceplot.marginals |